Iright
BRAND / VENDOR: Proteintech

Proteintech, 17421-1-AP, PLCL2 Polyclonal antibody

CATALOG NUMBER: 17421-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PLCL2 (17421-1-AP) by Proteintech is a Polyclonal antibody targeting PLCL2 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 17421-1-AP targets PLCL2 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information PLCL2, a novel phospholipase C-like protein, is expressed in lymphocytes and platelets. The expression of PLCL2 is associated with the proliferation of mature B cells in the immune system. PLCL2 is a new susceptibility loci for myocardial infarction. It has been shown that PLCL2 plays a key role in the pathogenesis of atherosclerosis and systemic sclerosisit. There are three isoforms of PLCL2 protein and 17421-1-AP antibody detects the 126 kDa band in SDS-PAGE. (PMID: 24916648, 25880423) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11443 Product name: Recombinant human PLCL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 653-1001 aa of BC036392 Sequence: VDPYVYVEIHGIPADCAEQRTKTVHQNGDAHIFDESFEFQINLPELAMVRFVVLDDDYIGDEFIGQYTIPFECLQTGYRHVPLQSLTGEVLAHASLFVHVAITNRRGGGKPRKRGLSVRKGKKSREYASLRTLWIKTVDEVFKNAQPPIRDATDLRENMQNAVVSFKELCGLSSVANLMQCMLAVSPRFLGPDNTPLVVLNLSEQYPTMELQGIVPEVLKKIVTTYDMMIQSLKALIENADAVYEKIVHCQKAAMEFHEHLHSIGTKEGLKERKLQKAVESFTWNITILKGQADLLKYAKNETLENLKQIHFAAVSCGLNKPGTENADVQKPRRSLEVIPEKANDETGE Predict reactive species Full Name: phospholipase C-like 2 Calculated Molecular Weight: 126 kDa Observed Molecular Weight: 126 kDa GenBank Accession Number: BC036392 Gene Symbol: PLCL2 Gene ID (NCBI): 23228 RRID: AB_2163732 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPR0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924