Proteintech, 17426-1-AP, MIER2 Polyclonal antibody

Size: 20ul / 150ul The MIER2 (17426-1-AP) by Proteintech is a Polyclonal antibody targeting MIER2 in WB, ELISA applications with reactivity to human, mouse, rat samples 17426-1-AP targets MIER2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, Jurkat cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Mesoderm induction early response 2 (MIER2) is a member of the MIER family of proteins, which is relatively conservative in evolution and includes three members: MIER1, MIER2, and MIER3. The MIER family is known to contribute to histone deacetylase (HDAC) activity and actively participate in histone deacetylation (PMID: 28046085; PMID: 38702028). In renal cell carcinoma, MIER2 represses PGC1A expression by recruiting HDAC1 to deacetylate P53 (PMID: 28046085). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11491 Product name: Recombinant human MIER2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 197-545 aa of BC028203 Sequence: IMVGPQFQADLSNLHLNRHCEKIYENEDQLLWDPSVLPEREVEEFLYRAVKRRWHEMAGPQLPEGEAVKDSEQALYELVKCNFNVEEALRRLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGECVEYYYLWKKSERYDYFAQQTRLGRRKYVPSGTTDADQDLDGSDPDGPGRPRPEQDTLTGMRTDPLSVDGTAGGLDEPGVASDGLPSSEPGPCSFQQLDESPAVPLSHRPPALADPASYQPAVTAPEPDASPRLAVDFALPKELPLISSHVDLSGDPEETVAPAQVALSVTEFGLIGIGDVNPFLAAHPTCPAPGLHSEPLSHCNVMTC Predict reactive species Full Name: mesoderm induction early response 1, family member 2 Calculated Molecular Weight: 545 aa, 60 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC028203 Gene Symbol: MIER2 Gene ID (NCBI): 54531 RRID: AB_2143931 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N344 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.