Proteintech, 17462-1-AP, Plasminogen Polyclonal antibody

Size: 20ul / 150ul The Plasminogen (17462-1-AP) by Proteintech is a Polyclonal antibody targeting Plasminogen in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 17462-1-AP targets Plasminogen in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human blood tissue, human placenta tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Plasminogen is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin. Plasminogen plays an important role in fibrinolysis as well as wound healing, cell migration, tissue modeling and angiogenesis. Plasminogen is synthesized in the liver, and it circulates in the blood, with a half-life of 2.2 days. Plasminogen is the precursor of plasmin, which lyses fibrin clots to fibrin degradation products (FDP) and D-dimer; the conversion to active protease is mediated by tissue-type (tPA) and urokinase-type (uPA) plasminogen activators. Defects in plasminogen are likely a cause of thrombophilia and ligneous conjunctivitis. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11217 Product name: Recombinant human PLG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 99-464 aa of BC060513 Sequence: YLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAP Predict reactive species Full Name: plasminogen Calculated Molecular Weight: 810 aa, 91 kDa Observed Molecular Weight: 97 kDa GenBank Accession Number: BC060513 Gene Symbol: Plasminogen Gene ID (NCBI): 5340 RRID: AB_10644136 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00747 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.