Iright
BRAND / VENDOR: Proteintech

Proteintech, 17469-1-AP, FMO3 Polyclonal antibody

CATALOG NUMBER: 17469-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FMO3 (17469-1-AP) by Proteintech is a Polyclonal antibody targeting FMO3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17469-1-AP targets FMO3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:100-1:500 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Microsomal flavin-containing monooxygenase (FMO) catalyzes the FAD-, NADPH-, and O2-dependent oxidation of a large number of xenobiotics containing soft nucleophiles,including alkaloids, pesticides, and pharmaceutical substances.Based on the cDNA sequence, the FMOs are classified into five subfamilies (FMO1 to FMO5) (PMID:11792679).In human beings, FMO3 is predominant in the adult liver, but not appear sex-dependent in the adult human liver. In the mouse liver, its expression has been shown to be sex-dependent and expressed only in females (PMID:11996886). Defects in FMO3 are the cause of trimethylaminuria (TMAU). This antibody is specific to FMO3. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11405 Product name: Recombinant human FMO3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 27-351 aa of BC032016 Sequence: EPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFSNSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFGTFLKNNLPTAISDWLYMKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVKPNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEII Predict reactive species Full Name: flavin containing monooxygenase 3 Calculated Molecular Weight: 532 aa, 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC032016 Gene Symbol: FMO3 Gene ID (NCBI): 2328 RRID: AB_2878410 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P31513 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924