Iright
BRAND / VENDOR: Proteintech

Proteintech, 17476-1-AP, CCR5 Polyclonal antibody

CATALOG NUMBER: 17476-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCR5 (17476-1-AP) by Proteintech is a Polyclonal antibody targeting CCR5 in IHC, ELISA applications with reactivity to human samples 17476-1-AP targets CCR5 in IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information CCR5 (also known as CD195) is a member of the beta chemokine receptor family. This protein is expressed by T cells and macrophages and is known to be an important co-receptor for macrophage-tropic viruses, including HIV, to enter host cells. The natural chemokine ligands that bind to CCR5 include MIP-1-alpha, MIP-1-beta, MCP-2, and RANTES. Specification Tested Reactivity: human Cited Reactivity: human, macaque Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11493 Product name: Recombinant human CCR5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 257-352 aa of BC038398 Sequence: LNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL Predict reactive species Full Name: chemokine (C-C motif) receptor 5 Calculated Molecular Weight: 352 aa, 41 kDa GenBank Accession Number: BC038398 Gene Symbol: CCR5 Gene ID (NCBI): 1234 RRID: AB_10895966 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51681 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924