Iright
BRAND / VENDOR: Proteintech

Proteintech, 17491-1-AP, USP20 Polyclonal antibody

CATALOG NUMBER: 17491-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The USP20 (17491-1-AP) by Proteintech is a Polyclonal antibody targeting USP20 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 17491-1-AP targets USP20 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, HeLa cells, HepG2 cells Positive IP detected in: HeLa cells Positive IHC detected in: human kidney tissue, human testis tissue, human brain tissue, human spleen tissue, human lung tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information USP20(ubiquitin carboxyl-terminal hydrolase 20) is also named as KIAA1003, LSFR3A, VDU2 and belongs to the peptidase C19 family and the USP20/USP33 subfamily. It can specifically deubiquitinate and stabilize HIF1A and, therefore, increase expression of HIF-1alpha targeted genes, such as vascular endothelial growth factor (VEGF). It also plays a central role in ADRB2 recycling and resensitization after prolonged agonist stimulation by constitutively binding ADRB2, mediating deubiquitination of ADRB2 and inhibiting lysosomal trafficking of ADRB2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11590 Product name: Recombinant human USP20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC039593 Sequence: MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADHSTIHAQAKKHNLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVD Predict reactive species Full Name: ubiquitin specific peptidase 20 Calculated Molecular Weight: 914 aa, 102 kDa Observed Molecular Weight: 110-120 kDa GenBank Accession Number: BC039593 Gene Symbol: USP20 Gene ID (NCBI): 10868 RRID: AB_2212570 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2K6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924