Iright
BRAND / VENDOR: Proteintech

Proteintech, 17502-1-AP, GSTCD Polyclonal antibody

CATALOG NUMBER: 17502-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GSTCD (17502-1-AP) by Proteintech is a Polyclonal antibody targeting GSTCD in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17502-1-AP targets GSTCD in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, L02 cells, mouse kidney tissue, mouse liver tissue Positive IHC detected in: human liver tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Glutathione S-transferase, C-terminal domain-containing protein (GSTCD) is widely expressed in cell types relevant to airway function, including airway smooth muscle cells and epithelial cells. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11690 Product name: Recombinant human GSTCD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 283-632 aa of BC032942 Sequence: FTLADIVLLPCIHHFLVIISRKFSEKLVEFPLLASWYQRIQEVPGVKTASKCGIQFLHLPKLLTTSTEQHPNLCEVPGVEEQSDPLFIGGPRPTMAKLMEKGIEVMFSPHPCPTWTLDWNVLPAAVSPKEGKMSSDRALRKQQQLNNLVYVVTNQAKPGDRIVDFCSGGGHVGIVLAHMLPSCQVTLIENKELSLIRAKKRSDELGLSNIWFIQANMEYFTGMFNIGVALHACGVATDMVIEHCIKTRASFVTCPCCYGFIQNTSKFNFPKSEQFKKTLSYKEHMILCRFADQTAVQLPPQRRLIGKQCMCLVDLDRARAAEECGYSVQVISMEPESCSPKNNMIVGVPI Predict reactive species Full Name: glutathione S-transferase, C-terminal domain containing Calculated Molecular Weight: 632 aa, 71 kDa Observed Molecular Weight: 71 kDa GenBank Accession Number: BC032942 Gene Symbol: GSTCD Gene ID (NCBI): 79807 RRID: AB_2115908 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NEC7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924