Iright
BRAND / VENDOR: Proteintech

Proteintech, 17510-1-AP, Histone H1.0 Polyclonal antibody

CATALOG NUMBER: 17510-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Histone H1 17510-1-AP targets Histone H1.0 in WB, IHC, IF/ICC, IF-P, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, A431 cells, mouse spleen tissue, rat spleen tissue Positive IP detected in: A431 cells Positive IHC detected in: skin cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Positive IF/ICC detected in: MCF-7 cells Positive ChIP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Chromatin immunoprecipitation (ChIP): CHIP : 1:10-1:100 Background Information Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures.Linker histones are involved in the formation of higher order structure in chromatin and the maintenance of overall chromatin compaction. The H1F0 histones are found in cells that are in terminal stages of differentiation or that have low rates of cell division.Histone H1.0 (H1F0,H1FV) is a linker histone that is widely expressed in many tissues and almost all vertebrates, unlike some other linker histones. The observed molecular weight of H1F0 is about 32 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9982 Product name: Recombinant human Histone H1.0 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-194 aa of BC000145 Sequence: MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK Predict reactive species Full Name: H1 histone family, member 0 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC000145 Gene Symbol: Histone H1.0 Gene ID (NCBI): 3005 RRID: AB_10695628 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07305 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924