Iright
BRAND / VENDOR: Proteintech

Proteintech, 17528-1-AP, AURKAIP1 Polyclonal antibody

CATALOG NUMBER: 17528-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AURKAIP1 (17528-1-AP) by Proteintech is a Polyclonal antibody targeting AURKAIP1 in IF/ICC, ELISA applications with reactivity to human samples 17528-1-AP targets AURKAIP1 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information AURKAIP1 (Aurora-A kinase interacting protein 1) has been identified as an Aurora-A kinase interacting protein involving in two degradation pathways of Aurora-A, including proteasome-dependent pathway and Ub-independent pathway . Ectopic expression of AURKAIP1 resulted in the down-regulation of Aurora-A protein levels and thus, AURKAIP1 could be regarded as a cancer suppressor involving Aurora-A pathway.(PMID: 38040691,PMID: 17125467) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11444 Product name: Recombinant human AURKAIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC062333 Sequence: MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRVCGPLYSTSPAGPGRAASLPRKGAQLELEEMLVPRKMSVSPLESWLTARCFLPRLDTGTAGTVAPPQSYQCPPSQIGEGAEQGDEGVADAPQIQCKNVLKIRRRKMNHHKYRKLVKKTRFLRRKVQEGRLRRKQIKFEKDLRRIWLKAGLKEAPEGWQTPKIYLRGK Predict reactive species Full Name: aurora kinase A interacting protein 1 Calculated Molecular Weight: 199 aa, 22 kDa GenBank Accession Number: BC062333 Gene Symbol: AURKAIP1 Gene ID (NCBI): 54998 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NWT8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924