Proteintech, 17537-1-AP, GGTLC1 Polyclonal antibody

Size: 20ul / 150ul The GGTLC1 (17537-1-AP) by Proteintech is a Polyclonal antibody targeting GGTLC1 in WB, IF/ICC, ELISA applications with reactivity to human samples 17537-1-AP targets GGTLC1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, L02 cells, human urine Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Gamma-glutamyltransferase light chain 1 (GGTLC1), initially named GGTL6, then GGTLA4, and later GGTLC1 in 2008, is a member of the gamma-glutamyl transferase (GGT) family. The most ubiquitously expressed human GGT gene, GGT1, encodes a single transmembrane polypeptide that is post-translationally processed to form a heavy and a light chain. Knockdown of GGTLC1 in Endometrial cancer (EC) cells was shown to induce G0/G1 phase arrest and apoptosis, underscoring the significance of GGTLC1 as a key regulator of these cellular processes in EC (PMID: 38841516). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11592 Product name: Recombinant human GGTLC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-225 aa of BC040904 Sequence: MTSEFFSAQLRAQISDDTTHPISYYKPEFYMPDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSSTSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVGAAGGTQITMATALAIIYNLWFGYDVKWAVEEPRLHNQLLPNVTTVERNIDQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY Predict reactive species Full Name: gamma-glutamyltransferase light chain 1 Calculated Molecular Weight: 225 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC040904 Gene Symbol: GGTLC1 Gene ID (NCBI): 92086 RRID: AB_3669277 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BX51 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.