Iright
BRAND / VENDOR: Proteintech

Proteintech, 17543-1-AP, MIER3 Polyclonal antibody

CATALOG NUMBER: 17543-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MIER3 (17543-1-AP) by Proteintech is a Polyclonal antibody targeting MIER3 in WB, ELISA applications with reactivity to human, mouse, rat samples 17543-1-AP targets MIER3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse uterus tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information The mesoderm induction early response (MIER) protein family is known as fibroblast growth factor (FGF)-regulated immediate-early protein family. Activated by FGF, MIER proteins may have a pivotal role in FGF-regulated cellular activities, indicating a potential influence in the progression of certain cancers [PMID:15117948]. MIER3 localizes to the nucleus and primarily functions as a transcriptional repressor. Rat mammary carcinoma susceptibility 1b (Mcs1b) is a quantitative trait locus on RN02 that confers decreased susceptibility when Copenhagen (COP)-resistant alleles are introgressed into a Wistar Furth (WF)-susceptible genome. MIER3 is a candidate Mcs1b gene [PMID:22993404]. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11604 Product name: Recombinant human MIER3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 177-522 aa of BC041348 Sequence: DQLLWCPDVVLESKVKEYLVETSLRTGSEKIMDRISAGTHTRDNEQALYELLKCNHNIKEAIERYCCNGKASQGMTAWTEEECRSFEHALMLFGKDFHLIQKNKVRTRTVAECVAFYYMWKKSERYDYFAQQTRFGKKRYNHHPGVTDYMDRLVDETEALGGTVNASALTSNRPEPIPDQQLNILNSFTASDLTALTNSVATVCDPTDVNCLDDSFPPLGNTPRGQVNHVPVVTEELLTLPSNGESDCFNLFETGFYHSELNPMNMCSEESERPAKRLKMGIAVPESFMNEVSVNNLGVDFENHTHHITSAKMAVSVADFGSLSANETNGFISAHALHQHAALHSE Predict reactive species Full Name: mesoderm induction early response 1, family member 3 Calculated Molecular Weight: 522 aa, 59 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC041348 Gene Symbol: MIER3 Gene ID (NCBI): 166968 RRID: AB_2143938 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z3K6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924