Iright
BRAND / VENDOR: Proteintech

Proteintech, 17554-1-AP, MTA2 Polyclonal antibody

CATALOG NUMBER: 17554-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MTA2 (17554-1-AP) by Proteintech is a Polyclonal antibody targeting MTA2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 17554-1-AP targets MTA2 in WB, IHC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, mouse thymus tissue, HEK-293 cells Positive IP detected in: mouse thymus tissue Positive IHC detected in: rat lung tissue, human heart tissue, rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Metastasis-associated protein MTA2, also named as MTA1L1 or PID, is a 668 amino acid protein, which contains one BAH domain, one ELM2 domain, one GATA-type zinc finger and one SANT domain. MTA2 localizes in the nucleus and is widely expressed in many tissues. MTA2 may be involved in the regulation of gene expression as repressor and activator. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11713 Product name: Recombinant human MTA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC053650 Sequence: MAANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLVEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVGTFARALDCSSSIRQPSLHMSAAAASRDITLFHAMDTLQRNGYDLAKAMSTLVPQGGPVLCRDEMEEWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKTTDRYIQQKRLKAAEADSKLKQVYIPTYTKPNPNQIISV Predict reactive species Full Name: metastasis associated 1 family, member 2 Calculated Molecular Weight: 668 aa, 75 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC053650 Gene Symbol: MTA2 Gene ID (NCBI): 9219 RRID: AB_10638601 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94776 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924