Iright
BRAND / VENDOR: Proteintech

Proteintech, 17576-1-AP, TSPYL4 Polyclonal antibody

CATALOG NUMBER: 17576-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TSPYL4 (17576-1-AP) by Proteintech is a Polyclonal antibody targeting TSPYL4 in WB, ELISA applications with reactivity to human, mouse, rat samples 17576-1-AP targets TSPYL4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10730 Product name: Recombinant human TSPYL4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 5-235 aa of BC009116 Sequence: KVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLERKFGRMRRLHMQRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMLRYMINLEVEELKHPRAGCKFKFIFQGNPYFRNEGLVKEYERRSSGRVVSLSTPIRWHRGQDPQAHIHRNREGNTIPSFFNWFSDHSLLEFDRIAEIIKGELWPNPLQYYLMGEGPRRGIRGPPRQPVESARSFRFQSG Predict reactive species Full Name: TSPY-like 4 Calculated Molecular Weight: 414 aa, 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC009116 Gene Symbol: TSPYL4 Gene ID (NCBI): 23270 RRID: AB_2272537 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UJ04 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924