Iright
BRAND / VENDOR: Proteintech

Proteintech, 17589-1-AP, ATP5H Polyclonal antibody

CATALOG NUMBER: 17589-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATP5H (17589-1-AP) by Proteintech is a Polyclonal antibody targeting ATP5H in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 17589-1-AP targets ATP5H in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse liver tissue, rat brain tissue, rat liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: human lung cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Mitochondrial membrane ATP synthase (F1-Fo ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. It is composed of the soluble catalytic core, F1, and the membrane-spanning component and Fo, which comprises the proton channel. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP5H gene encodes ATP synthase subunit d of the Fo complex. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11429 Product name: Recombinant human ATP5H protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC032245 Sequence: MAGRKLALKTIDWVAFAEIIPQNQKAIASSLKSWNETLTSRLAALPENPPAIDWAYYKANVAKAGLVDDFEKKVKSCAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKYPYWPHQPIENL Predict reactive species Full Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d Calculated Molecular Weight: 137 aa, 16 kDa Observed Molecular Weight: 19-22 kDa GenBank Accession Number: BC032245 Gene Symbol: ATP5H Gene ID (NCBI): 10476 RRID: AB_2062046 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75947 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924