Proteintech, 17612-1-AP, KLF17 Polyclonal antibody

Size: 20ul / 150ul The KLF17 (17612-1-AP) by Proteintech is a Polyclonal antibody targeting KLF17 in WB, ELISA applications with reactivity to human samples 17612-1-AP targets KLF17 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11776 Product name: Recombinant human KLF17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-389 aa of BC049844 Sequence: MYGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSWNQGLPTIQHFPHSAEMLGSPLVSVEAPGQNVNEGGPQFSMPLPERGMSYCPQATLTPSRMIYCQRMSPPQQEMTIFSGPQLMPVGEPNIPRVARPFGGNLRMPPSGLPVSASTGIPIMSHTGNPPVPYPGLSTVPSDETLLGPTVPSTEAQAVLPSMAQMLPPQDAHDLGMPPAESQSLLVLGSQDSLVSQPDSQEGPFLPEQPGPAPQTVEKNSRPQEGTGRRGSSEARPYCCNYENCGKAYTKRSHLVSHQRKHTGERPYSCNWESCSWSFFRSDELRRHMRVHTRYRPYKCDQCSREFMRSDHLKQHQKTHRPGPSDPQANNNNGEQDSPPAAGP Predict reactive species Full Name: Kruppel-like factor 17 Calculated Molecular Weight: 389 aa, 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC049844 Gene Symbol: KLF17 Gene ID (NCBI): 128209 RRID: AB_2878419 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5JT82 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.