Iright
BRAND / VENDOR: Proteintech

Proteintech, 17614-1-AP, NDUFB2 Polyclonal antibody

CATALOG NUMBER: 17614-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NDUFB2 (17614-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFB2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 17614-1-AP targets NDUFB2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, mouse spleen tissue, human heart tissue, mouse heart tissue, rat heart tissue, HuH-7 cells, MCF-7 cells, mouse brain tissue, mouse kidney tissue Positive IHC detected in: mouse brain tissue, human brain tissue, human heart tissue, human kidney tissue, human liver tissue, human ovary tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: C2C12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The multisubunit NADH:ubiquinone oxidoreductase (complex I) is the first enzyme complex in the electron transport chain of mitochondria. NDUFB2, also named as CI-AGGG, is a nuclear encoded subunit located in the hydrophobic protein fraction of complex I(PMID:9878551). It may have a role in the regulation of molecular changes during the global cardiac ischemia/reperfusion injury during cardiopulmonary bypass (CPB). The full length 12 kDa protein has a transit peptide with 33 amino acids. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11789 Product name: Recombinant human NDUFB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC063026 Sequence: MESHERQPLVLHEEMGECRSSLSAGGGVHIEPRYRQFPQLTRSQVFQSEFFSGLMWFWILWRFWHDSEEVLGHFPYPDPSQWTDEELGIPPDDED Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2, 8kDa Calculated Molecular Weight: 95 aa, 11 kDa Observed Molecular Weight: 8-12 kDa GenBank Accession Number: BC063026 Gene Symbol: NDUFB2 Gene ID (NCBI): 4708 RRID: AB_2150944 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95178 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924