Iright
BRAND / VENDOR: Proteintech

Proteintech, 17638-1-AP, MON1B Polyclonal antibody

CATALOG NUMBER: 17638-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MON1B (17638-1-AP) by Proteintech is a Polyclonal antibody targeting MON1B in WB, IF/ICC, ELISA applications with reactivity to human samples 17638-1-AP targets MON1B in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, K-562 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Vacuolar fusion protein MON1 homolog B (MON1B) is also named as HSRG1, KIAA0872 and SAND2, and belongs to the MON1/SAND family. The membrane recruitment of MON1B, a homolog of yeast MON1 protein in mammals, is essential for vesicular fusion of early endosomes (PMID:26987402). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9920 Product name: Recombinant human MON1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 199-547 aa of BC024277 Sequence: STLTRASVARIFAHKQNYDLRRLLAGSERTLDRLLDSMEQDPGALLLGAVRCVPLARPLRDALGALLRRCTAPGLALSVLAVGGRLITAAQERNVLAECRLDPADLQLLLDWVGAPAFAAGEAWAPVCLPRFNPDGFFYAYVARLDAMPVCLLLLGTQREAFHAMAACRRLVEDGMHALGAMRALGEAASFSNASSASAPAYSVQAVGAPGLRHFLYKPLDIPDHHRQLPQFTSPELEAPYSREEERQRLSDLYHRLHARLHSTSRPLRLIYHVAEKETLLAWVTSKFELYTCLSPLVTKAGAILVVTKLLRWVKKEEDRLFIRYPPKYSTPPATSTDQAAHNGLFTGL Predict reactive species Full Name: MON1 homolog B (yeast) Calculated Molecular Weight: 547 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC024277 Gene Symbol: MON1B Gene ID (NCBI): 22879 RRID: AB_2918054 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L1V2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924