Iright
BRAND / VENDOR: Proteintech

Proteintech, 17642-1-AP, C7 Polyclonal antibody

CATALOG NUMBER: 17642-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C7 (17642-1-AP) by Proteintech is a Polyclonal antibody targeting C7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17642-1-AP targets C7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse thymus tissue, human blood tissue Positive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The complement system is an important effector that bridges the innate and adaptive immune systems (PMID: 20010915). Complement component 7 (C7) is a single-chain plasma glycoprotein that is the final product of the complement cascade and plays a central role in the activation of the complement system. It is a constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells (PMID: 10886232; PMID: 27852032). C7 is a potential tumor suppressor and a prognostic biomarker for prostate cancer and renal cell carcinoma (PMID: 32984006; PMID: 33158953). C7 serves as a membrane anchor. People with C7 deficiency are prone to bacterial infection (PMID: 19758139). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11819 Product name: Recombinant human C7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 310-690 aa of BC063851 Sequence: GGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENALKAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQKLTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPEMKNARCVQ Predict reactive species Full Name: complement component 7 Calculated Molecular Weight: 843 aa, 94 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC063851 Gene Symbol: C7 Gene ID (NCBI): 730 RRID: AB_1959350 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10643 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924