Iright
BRAND / VENDOR: Proteintech

Proteintech, 17651-1-AP, PTRH1 Polyclonal antibody

CATALOG NUMBER: 17651-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PTRH1 (17651-1-AP) by Proteintech is a Polyclonal antibody targeting PTRH1 in WB, ELISA applications with reactivity to human samples 17651-1-AP targets PTRH1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, Caco-2 cells, HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Peptidyl-tRNA hydrolase 1 homolog(PTRH1), also known as PTH1, is peptidyl-tRNA hydrolase that cleaves nascent chains-tRNAs that are not stably fixed in the P-site of 60S ribosome-nascent chain complexes. PTRH1 functions in the ribosome-associated quality control (RQC) pathway and is involved in the degradation of nonubiquitinated nascent chain (NC) polypeptides arising from interrupted translation(PMID:30244831). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11893 Product name: Recombinant human PTRH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-214 aa of BC047012 Sequence: MRPGGFLGAGQRLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRHSVGMAVLGQLARRLGVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAAELFGLTAEEVYLVHDELDKPLGRLALKLGGSARGHNGVRSCISCLNSNAMPRLRVGIGRPAHPEAVQAHVLGCFSPAEQELLPLLLDRATDLILDHIRERSQGPSLGP Predict reactive species Full Name: peptidyl-tRNA hydrolase 1 homolog (S. cerevisiae) Calculated Molecular Weight: 214 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC047012 Gene Symbol: PTRH1 Gene ID (NCBI): 138428 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86Y79 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924