Proteintech, 17659-1-AP, SENP3 Polyclonal antibody

Size: 20ul / 150ul The SENP3 (17659-1-AP) by Proteintech is a Polyclonal antibody targeting SENP3 in WB, IHC, IP, ELISA applications with reactivity to human, rat samples 17659-1-AP targets SENP3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Y79 cells, rat embryo tissue Positive IP detected in: Y79 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information SENP3(Sentrin-specific protease 3) is also named as SSP3, SUSP3 and belongs to the peptidase C48 family. It acts as an essential factor for ribosome biogenesis. SENP3 might regulate the sumoylation of other substrates through directly binding or mediating association with NPM1 at the nucleolus and other subcellular compartments. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11911 Product name: Recombinant human SENP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-574 aa of BC080658 Sequence: GLRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHVAQELFQGSDLGMAEEAERPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV Predict reactive species Full Name: SUMO1/sentrin/SMT3 specific peptidase 3 Calculated Molecular Weight: 574 aa, 65 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC080658 Gene Symbol: SENP3 Gene ID (NCBI): 26168 RRID: AB_2301618 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H4L4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.