Proteintech, 17678-1-AP, MSX1 Polyclonal antibody

Size: 20ul / 150ul The MSX1 (17678-1-AP) by Proteintech is a Polyclonal antibody targeting MSX1 in WB, ELISA applications with reactivity to human, mouse, rat samples 17678-1-AP targets MSX1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information MSX1, also known as, Homeobox protein Hox-7 or Msh homeobox 1-like protein, is a 303 maino acid protein, which plays an important role during embryogenesis. Msx1 was the first mammalian member of the Msx subfamily of homeobox genes that was described,and it was isolated from a cDNA library prepared from mouse 8.5-day embryos. Expression of Msx1 has been described during embryogenesis of limb buds, genital ridges, visceral arches, craniofacial structures, central nervous system, and the developing pituitary gland. Msx1 expression in adult mouse uterus and mammary gland has also been reported recently. (PMID: 9369446). MSX1 displays homology to the Drosophilamuscle segment homeobox (msh) gene, which is important in development. MSX1 encodes important genes that regulate numerous morphogenic events, such as tooth formation, bone development, development of the central nervous system, and the development and proliferation of various cell types (PMID: 18379900) . Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11700 Product name: Recombinant human MSX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC021285 Sequence: MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT Predict reactive species Full Name: msh homeobox 1 Calculated Molecular Weight: 303 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC021285 Gene Symbol: MSX1 Gene ID (NCBI): 4487 RRID: AB_2878426 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P28360 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.