Proteintech, 17716-1-AP, USMG5 Polyclonal antibody

Size: 20ul / 150ul The USMG5 (17716-1-AP) by Proteintech is a Polyclonal antibody targeting USMG5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17716-1-AP targets USMG5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, human liver tissue, human brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12086 Product name: Recombinant human USMG5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-58 aa of BC072683 Sequence: MAGPESDAQYQFTGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLRSKKTPAVKAT Predict reactive species Full Name: up-regulated during skeletal muscle growth 5 homolog (mouse) Calculated Molecular Weight: 58 aa, 7 kDa Observed Molecular Weight: 6 kDa GenBank Accession Number: BC072683 Gene Symbol: USMG5 Gene ID (NCBI): 84833 RRID: AB_2214288 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96IX5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.