Iright
BRAND / VENDOR: Proteintech

Proteintech, 17718-1-AP, METTL4 Polyclonal antibody

CATALOG NUMBER: 17718-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The METTL4 (17718-1-AP) by Proteintech is a Polyclonal antibody targeting METTL4 in WB, ELISA applications with reactivity to human, mouse, rat samples 17718-1-AP targets METTL4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Methyltransferase like protein 4 (METTL4) is a internal m6Am methyltransferase, which mediates N6-methylation of Am30 on U2 snRNA in the context of an AAG motif in vivo and in vitro. METTL4 belongs to the MT-A70-like family, and like its paralogs METTL3/14, METTL4 is conserved from yeast to human. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12093 Product name: Recombinant human METTL4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 125-472 aa of BC111020 Sequence: ISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFEKQDKGSKPITLPLDACSLSELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVENNSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKTFDVIVIDPPWQNKSVKRSNRYSYLSPLQIKQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEVVAEWHWVKITNSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHKPPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIALESGS Predict reactive species Full Name: methyltransferase like 4 Calculated Molecular Weight: 472 aa, 54 kDa GenBank Accession Number: BC111020 Gene Symbol: METTL4 Gene ID (NCBI): 64863 RRID: AB_2142047 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N3J2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924