Proteintech, 17726-1-AP, Arfaptin-1 Polyclonal antibody

Size: 20ul / 150ul The Arfaptin-1 (17726-1-AP) by Proteintech is a Polyclonal antibody targeting Arfaptin-1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 17726-1-AP targets Arfaptin-1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: BxPC-3 cells, HCT 116 cells, HeLa cells, HepG2 cells, Jurkat cells, Raw 264.7 cells, mouse brain tissue Positive IHC detected in: human breast cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12122 Product name: Recombinant human ARFIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-373 aa of BC103759 Sequence: MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQTLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAHKEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWLEEQ Predict reactive species Full Name: ADP-ribosylation factor interacting protein 1 Calculated Molecular Weight: 373 aa, 42 kDa Observed Molecular Weight: 42 kDa, 38 kDa, 22 kDa GenBank Accession Number: BC103759 Gene Symbol: Arfaptin-1 Gene ID (NCBI): 27236 RRID: AB_2227457 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P53367 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.