Proteintech, 17744-1-AP, DCP2 Polyclonal antibody

Size: 20ul / 150ul The DCP2 (17744-1-AP) by Proteintech is a Polyclonal antibody targeting DCP2 in WB, IHC, ELISA applications with reactivity to human samples 17744-1-AP targets DCP2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, Caco-2 cells, T-47D cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12001 Product name: Recombinant human DCP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-385 aa of BC064593 Sequence: METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL Predict reactive species Full Name: DCP2 decapping enzyme homolog (S. cerevisiae) Calculated Molecular Weight: 385aa,44 kDa; 420aa,48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC064593 Gene Symbol: DCP2 Gene ID (NCBI): 167227 RRID: AB_3085538 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IU60 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.