Iright
BRAND / VENDOR: Proteintech

Proteintech, 17754-1-AP, PARP8 Polyclonal antibody

CATALOG NUMBER: 17754-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PARP8 (17754-1-AP) by Proteintech is a Polyclonal antibody targeting PARP8 in IP, ELISA applications with reactivity to human samples 17754-1-AP targets PARP8 in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: THP-1 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Protein mono-ADP-ribosyltransferase PARP8, also known as ADP-ribosyltransferase diphtheria toxin-like 16 (ARTD16), is primarily localised on the nuclear envelope for the majority of the cell cycle but localises to centrosomes and spindle poles during mitosis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12111 Product name: Recombinant human PARP8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 462-812 aa of BC075801 Sequence: IGILTPSSSSSSQLAPNGAKCIPVRDRGFLVQTIEFAEQRIPVLNEYCVVCDEPHVFQNGPMLRPTVCERELCVFAFQTLGVMNEAADEIATGAQKKNYDRVMKALDSITSIREMTQAPYLEIKKQMDKQDPLAHPLLQWVISSNRSHIVKLPVNRQLKFMHTPHQFLLLSSPPAKESNFRAAKKLFGSTFAFHGSHIENWHSILRNGLVVASNTRLQLHGAMYGSGIYLSPMSSISFGYSGMNKKQKVSAKDEPASSSKSSNTSQSQKKGQQSQFLQSRNLKCIALCEVITSSDLHKHGEIWVVPNTDHVCTRFFFVYEDGQVGDANINTQEGGIHKEILRVIGNQTATG Predict reactive species Full Name: poly (ADP-ribose) polymerase family, member 8 Calculated Molecular Weight: 812 aa, 91 kDa Observed Molecular Weight: 91-96 kDa GenBank Accession Number: BC075801 Gene Symbol: PARP8 Gene ID (NCBI): 79668 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N3A8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924