Iright
BRAND / VENDOR: Proteintech

Proteintech, 17755-1-AP, RANBP9 Polyclonal antibody

CATALOG NUMBER: 17755-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RANBP9 (17755-1-AP) by Proteintech is a Polyclonal antibody targeting RANBP9 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, canine samples 17755-1-AP targets RANBP9 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat, canine samples. Tested Applications Positive WB detected in: mouse brain tissue, HeLa cells, mouse testis Positive IP detected in: HeLa cells Positive IHC detected in: human testis tissue, human skin tissue, mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat, canine Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12112 Product name: Recombinant human RANBP9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-389 aa of BC063849 Sequence: MREWRTKIQAQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVPELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRDCGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGIGSCAFATVEDYLH Predict reactive species Full Name: RAN binding protein 9 Calculated Molecular Weight: 388aa,43 kDa; 729aa,78 kDa Observed Molecular Weight: 80-90 kDa GenBank Accession Number: BC063849 Gene Symbol: RANBP9 Gene ID (NCBI): 10048 RRID: AB_2176803 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96S59 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924