Iright
BRAND / VENDOR: Proteintech

Proteintech, 17765-1-AP, HSF5 Polyclonal antibody

CATALOG NUMBER: 17765-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HSF5 (17765-1-AP) by Proteintech is a Polyclonal antibody targeting HSF5 in WB, IF-P, ELISA applications with reactivity to human samples 17765-1-AP targets HSF5 in WB, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IF-P detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Heat shock transcription factor 5 (HSF5) is a member of the HSF family, which are well-known transcriptional regulators of genes encoding heat shock proteins and other types of proteins and have functions in reproduction, the immune response, and the aging process. HSF5 is a non-canonical HSF that possesses a winged- helix-turn-helix (WHTH)-like DNA-binding domain and is specifically expressed in the testis (PMID: 38958533, PMID: 39162221). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12168 Product name: Recombinant human HSF5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC033017 Sequence: MEALLSTPINPNNFPAKLWRLVNSPRYRSIRWDGRGEGLLIDQPLFEAELLSPPGPGGGGGTAGAGAEPELFKTTSFTSFIRQLNLYGFRKVVLGGPGGGKPAGNGPLHHFHNPHFRRDQPQLLVHLKRLTSANKAKLAAGLEVPCRPPNRFQRLLITSASAATAPLQHQQPPPPAGPRPEPHGPVAVGQFHRSFRRDSLSPYSCVSTPSHDHSTYPLKGLDRTPVPHRIWQNSLGMHPGQVETSPTFSDKGVPFPVLQRFPTEVTYTLQPSTTSVHVQQGPQTMVSSSQKYSNYTPSAQYSQAYYPTAVLQCCSPTHMDALSSCVTPTASSYAHCNYFQNPSMQSSYPV Predict reactive species Full Name: heat shock transcription factor family member 5 Calculated Molecular Weight: 596 aa, 65 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC033017 Gene Symbol: HSF5 Gene ID (NCBI): 124535 RRID: AB_2233301 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q4G112 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924