Proteintech, 17779-1-AP, UCRC Polyclonal antibody

Size: 20ul / 150ul The UCRC (17779-1-AP) by Proteintech is a Polyclonal antibody targeting UCRC in WB, ELISA applications with reactivity to human, mouse, rat samples 17779-1-AP targets UCRC in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human heart tissue, human liver tissue, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10911 Product name: Recombinant human UCRC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC005402 Sequence: MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK Predict reactive species Full Name: ubiquinol-cytochrome c reductase complex (7.2 kD) Calculated Molecular Weight: 63 aa, 7 kDa Observed Molecular Weight: 7 kDa GenBank Accession Number: BC005402 Gene Symbol: UCRC Gene ID (NCBI): 29796 RRID: AB_2035028 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UDW1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.