Iright
BRAND / VENDOR: Proteintech

Proteintech, 17808-1-AP, IAH1 Polyclonal antibody

CATALOG NUMBER: 17808-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IAH1 (17808-1-AP) by Proteintech is a Polyclonal antibody targeting IAH1 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 17808-1-AP targets IAH1 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, mouse brain tissue, mouse kidney tissue Positive IP detected in: mouse kidney tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12089 Product name: Recombinant human IAH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-248 aa of BC111025 Sequence: MALCEAAGCGSALLWPRLLLFGDSITQFSFQQGGWGASLADRLVRKCDVLNRGFSGYNTRWAKIILPRLIRKGNSLDIPVAVTIFFGANDSALKDENPKQHIPLEEYAANLKSMVQYLKSVDIPENRVILITPTPLCETAWEEQCIIQGCKLNRLNSVVGEYANACLQVAQDCGTDVLDLWTLMQDSQDFSSYLSDGLHLSPKGNEFLFSHLWPLIEKKVSSLPLLLPYWRDVAEAKPELSLLGDGDH Predict reactive species Full Name: isoamyl acetate-hydrolyzing esterase 1 homolog (S. cerevisiae) Calculated Molecular Weight: 248 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC111025 Gene Symbol: IAH1 Gene ID (NCBI): 285148 RRID: AB_2123524 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q2TAA2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924