Iright
BRAND / VENDOR: Proteintech

Proteintech, 17815-1-AP, STX17 Polyclonal antibody

CATALOG NUMBER: 17815-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STX17 (17815-1-AP) by Proteintech is a Polyclonal antibody targeting STX17 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 17815-1-AP targets STX17 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, L02 cells, human testis tissue, mouse testis tissue, A375 cells, rat testis tissue, Jurkat cells Positive IP detected in: HepG2 cells Positive IHC detected in: mouse testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for the fusion of cellular membranes. Syntaxin 17 (STX17) is a SNARE of the autophagosome involved in autophagy through the direct control of autophagosome membrane fusion with the lysosome membrane. STX17 may also play a role in the early secretory pathway where it may maintain the architecture of the endoplasmic reticulum-Golgi intermediate compartment/ERGIC and Golgi and/or regulate transport between the endoplasmic reticulum, the ERGIC, and the Golgi. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12134 Product name: Recombinant human STX17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-216 aa of BC111009 Sequence: MSEDEEKVKLRRLEPAIQKFIKIVIPTDLERLRKHQINIEKYQRCGIWDKLHEEHINAGRTVQQLRSNIREIEKLCLKVRKDDLVLLKRMIDPVKEEASAATAEFLQLHLESVEELKKQFNDEETLLQPPLTRSMTVGGAFHTTEAEASSQSLTQIYALPEIPQDQNAAESWETLEADLIELSQLVTDFSLLVNSQQEKIDSIADHVNSAAVNVEE Predict reactive species Full Name: syntaxin 17 Calculated Molecular Weight: 302 aa, 33 kDa Observed Molecular Weight: 33-38 kDa GenBank Accession Number: BC111009 Gene Symbol: STX17 Gene ID (NCBI): 55014 RRID: AB_2255542 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56962 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924