Iright
BRAND / VENDOR: Proteintech

Proteintech, 17820-1-AP, SLC22A14 Polyclonal antibody

CATALOG NUMBER: 17820-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC22A14 (17820-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A14 in WB, ELISA applications with reactivity to human samples 17820-1-AP targets SLC22A14 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SLC22A14 belongs to the organic anion/cation transporter family and is conserved in many mammals with 12 transmembrane regions. It has been reported that SLC22A14 is expressed ubiquitously but is highly expressed in testis located to the principal piece of spermatozoa. SLC22A14 plays a pivotal role in flagellar structure, sperm motility and fertility in mice. (PMID: 27811987, 10072596) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12180 Product name: Recombinant human SLC22A14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC075071 Sequence: MAGEENFKEELRSQDASRNLNQHEVAGHPHSWSLEMLLRRLRAVHTKQDDKFANLLDAVGEFGTFQQRLVALTFIPSIMSAFFMFADHFVFTAQKPYCNTSWILAVGPHLSKAEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAGLPIGSLI Predict reactive species Full Name: solute carrier family 22, member 14 Calculated Molecular Weight: 594 aa, 67 kDa Observed Molecular Weight: 67 kDa GenBank Accession Number: BC075071 Gene Symbol: SLC22A14 Gene ID (NCBI): 9389 RRID: AB_2878445 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y267 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924