Iright
BRAND / VENDOR: Proteintech

Proteintech, 17822-1-AP, DOK1 Polyclonal antibody

CATALOG NUMBER: 17822-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DOK1 (17822-1-AP) by Proteintech is a Polyclonal antibody targeting DOK1 in WB, IHC, ELISA applications with reactivity to human samples 17822-1-AP targets DOK1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The downstream of tyrosine kinase 1gene (DOK1) has emerged as a newly identified tumor suppressor gene that encodes a multi-domain adapter protein and acts as a negative regulator of signaling pathways involved in several cellular functions. DOK1 inhibits cell proliferation, down regulates MAP kinase activity, and has an opposing role in leukemogenesis and promotes cell spreading, motility, and apoptosis. (PMID: 24809689) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12189 Product name: Recombinant human DOK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-267 aa of BC111055 Sequence: MFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELLDSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYWDLYEHAQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGLYDLPREPKDAWWCQARVKEEGYELPYNPATDDYAVPPPRSTKPLLAPKPQGPAFPEPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST Predict reactive species Full Name: docking protein 1, 62kDa (downstream of tyrosine kinase 1) Calculated Molecular Weight: 48 aa, 52 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC111055 Gene Symbol: DOK1 Gene ID (NCBI): 1796 RRID: AB_2274420 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99704 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924