Proteintech, 17844-1-AP, CHRNB2 Polyclonal antibody

Size: 20ul / 150ul The CHRNB2 (17844-1-AP) by Proteintech is a Polyclonal antibody targeting CHRNB2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17844-1-AP targets CHRNB2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, mouse brain tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12208 Product name: Recombinant human CHRNB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-227 aa of BC075041 Sequence: LLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYD Predict reactive species Full Name: cholinergic receptor, nicotinic, beta 2 (neuronal) Calculated Molecular Weight: 502 aa, 57 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC075041 Gene Symbol: CHRNB2 Gene ID (NCBI): 1141 RRID: AB_2878450 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17787 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.