Iright
BRAND / VENDOR: Proteintech

Proteintech, 17868-1-AP, CYP2D6/7 Polyclonal antibody

CATALOG NUMBER: 17868-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CYP2D6/7 (17868-1-AP) by Proteintech is a Polyclonal antibody targeting CYP2D6/7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 17868-1-AP targets CYP2D6/7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: human liver cancer tissue, human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:200-1:600 Background Information CYP2D6(Cytochrome P450 2D6) is also named as CYP2DL1 and belongs to the cytochrome P450 family. It is a monooxygenase that involved in the metabolism of drugs such as antiarrhythmics, adrenoceptor antagonists, and tricyclic antidepressants. CYP2D6 is responsible for the metabolism of many drugs and environmental chemicals that it oxidizes. It has 2 isoforms produced by alternative splicing with the molecular weight of 56 kDa and 50 kDa. This antibody can recognize human CYP2D6/7, mouse CYP2D3/4/9/10/22/26, rat CYP2D1/3/4/10/26, due to the high homology. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12351 Product name: Recombinant human CYP2D6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 148-497 aa of BC075023 Sequence: SLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR Predict reactive species Full Name: cytochrome P450, family 2, subfamily D, polypeptide 6 Calculated Molecular Weight: 497 aa, 56 kDa Observed Molecular Weight: 48-56 kDa GenBank Accession Number: BC075023 Gene Symbol: CYP2D6 Gene ID (NCBI): 1565 RRID: AB_2878457 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10635 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924