Iright
BRAND / VENDOR: Proteintech

Proteintech, 17917-1-AP, EIF4B Polyclonal antibody

CATALOG NUMBER: 17917-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EIF4B (17917-1-AP) by Proteintech is a Polyclonal antibody targeting EIF4B in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 17917-1-AP targets EIF4B in WB, IHC, IF/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells, sodium arsenite treated HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information EIF4B is one of the mammalian eukaryotic initiation factors (eIF) that are required for the ATP-dependent binding of mRNA to the 40 S ribosomal subunit, and the other eIF proteins are EIF4A, EIF4F. eIF4B is involved in translation of numerous proliferative or anti-apoptotic mRNAs with highly structured 5'UTR and subsequently affect cell growth and survival. It was reported that false expression and phosphorylation levels of eIF4B are involved in several tumors including breast cancer, cell lymphoblastic leukemia and diffuse large B-cell lymphoma (PMID: 26848623). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12325 Product name: Recombinant human EIF4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC073154 Sequence: MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDDDVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSAS Predict reactive species Full Name: eukaryotic translation initiation factor 4B Calculated Molecular Weight: 611 aa, 69 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC073154 Gene Symbol: EIF4B Gene ID (NCBI): 1975 RRID: AB_2097541 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23588 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924