Proteintech, 17920-1-AP, KCNE2 Polyclonal antibody

Size: 20ul / 150ul The KCNE2 (17920-1-AP) by Proteintech is a Polyclonal antibody targeting KCNE2 in WB, ELISA applications with reactivity to mouse, rat samples 17920-1-AP targets KCNE2 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse pancreas tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Potassium voltage-gated channel subfamily E regulatory subunit 2 (KCNE2, also known as LQT5, LQT6, ATFB4, and MIRP1) functions as a regulatory subunit of the voltage-gated potassium (Kv) channel complex composed of pore-forming and potassium-conducting alpha subunits and of regulatory beta subunits (PMID: 10219239; 11034315; 11101505; 12185453; 20533308). KCNE2 beta subunit modulates the gating kinetics and enhances the stability of the channel complex (PMID: 10219239; 11034315; 11101505; 12185453; 20533308). It is expressed in various parts of the heart, with higher levels observed in the ventricles and Purkinje tissues compared to the atria (PMID: 39272981). KCNE2 has three forms, such as the core (15 kDa), singly glycosylated (20 kDa), and doubly glycosylated (25 kDa) forms (PMID: 15066947). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12336 Product name: Recombinant human KCNE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC093892 Sequence: MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNLEESKATIHENIGAAGFKMSP Predict reactive species Full Name: potassium voltage-gated channel, Isk-related family, member 2 Calculated Molecular Weight: 123 aa, 14 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC093892 Gene Symbol: KCNE2 Gene ID (NCBI): 9992 RRID: AB_3669283 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6J6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.