Iright
BRAND / VENDOR: Proteintech

Proteintech, 17921-1-AP, ING1 Polyclonal antibody

CATALOG NUMBER: 17921-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ING1 (17921-1-AP) by Proteintech is a Polyclonal antibody targeting ING1 in WB, ELISA applications with reactivity to mouse, human samples 17921-1-AP targets ING1 in WB, ELISA applications and shows reactivity with mouse, human samples. Tested Applications Positive WB detected in: mouse liver tissue, A375 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ING1, also inhibitor of growth protein 1, is a 422 amino acid protein, which contains 1 PHD-type zinc finger and belongs to the ING family. ING1 localizes in the nucleus and interacts with TP53. It exsits as varous isoforms and isoform 1 is a 47 kDa protein. Isoform 2 is a 33 kDa protein and expressed in all normal tissues, as well as in all breast cancer and melanoma cell lines examined. ING1 cooperates with p53/TP53 in the negative regulatory pathway of cell growth by modulating p53-dependent transcriptional activation. It is implicated as a tumor suppressor gene. Specification Tested Reactivity: mouse, human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12338 Product name: Recombinant human ING1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-279 aa of BC093942 Sequence: MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR Predict reactive species Full Name: inhibitor of growth family, member 1 Calculated Molecular Weight: 279aa,32 kDa; 422aa,47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC093942 Gene Symbol: ING1 Gene ID (NCBI): 3621 RRID: AB_2878467 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UK53 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924