Iright
BRAND / VENDOR: Proteintech

Proteintech, 17927-1-AP, HESX1 Polyclonal antibody

CATALOG NUMBER: 17927-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HESX1 (17927-1-AP) by Proteintech is a Polyclonal antibody targeting HESX1 in IHC, ELISA applications with reactivity to human, mouse, rat samples 17927-1-AP targets HESX1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information HESX1 (Homeobox gene expressed in stem cells 1) is a homeobox transcriptional repressor that was initially isolated from murine embryonic stem cells (ESCs). Hesx1 is crucial for proper forebrain and pituitary development in both mice and humans, and inactivating mutations in HESX1 underlie septo-optic dysplasia. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12348 Product name: Recombinant human HESX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-185 aa of BC093979 Sequence: MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE Predict reactive species Full Name: HESX homeobox 1 Calculated Molecular Weight: 185 aa, 21 kDa GenBank Accession Number: BC093979 Gene Symbol: HESX1 Gene ID (NCBI): 8820 RRID: AB_2118120 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBX0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924