Iright
BRAND / VENDOR: Proteintech

Proteintech, 17935-1-AP, CNOT6 Polyclonal antibody

CATALOG NUMBER: 17935-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CNOT6 (17935-1-AP) by Proteintech is a Polyclonal antibody targeting CNOT6 in WB, ELISA applications with reactivity to human samples 17935-1-AP targets CNOT6 in WB, RIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information The evolutionarily conserved CCR4-NOT (CNOT) complex regulates mRNA metabolism in eukaryotic cells. This regulation occurs at different levels of mRNA synthesis and degradation, including transcription initiation, elongation, deadenylation, and degradation (PMID: 12882519). Multiple components, including CNOT1, CNOT2, CNOT3, CNOT4, CNOT6, CNOT6L, CNOT7, CNOT8, CNOT9, and CNOT10 have been identified in this complex (PMID: 19558367). In addition, the subunit composition of this complex has been shown to vary among different tissues (PMID: 21741365). The various CNOT proteins display different functions, with CNOT6, CNOT6L, CNOT7, and CNOT8 exhibiting 3'-5' RNAse activity (PMID: 11889047). Research studies indicate that the CCR4-NOT deadenylase subunits CNOT6 and CNOT6L help mediate cell survival and play a role in cell proliferation, P-body formation, and regulation of gene expression (PMID: 21233283). Additional research evidence suggests that CNOT6 can act as a nuclear hormone receptor coactivator that associates with ZNF335 (NIF-1) to regulate expression from specific RARα regulated genes (PMID: 18180299). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11506 Product name: Recombinant human CNOT6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC027476 Sequence: MCIMTISSEGELELVGLMRLRKQLFLRSALCNHRSRELYGSGRGGALTHVVFVNGGCHLFIDAGTRVHLLDAKGLSFTQNVFICICYCLQYI Predict reactive species Full Name: CCR4-NOT transcription complex, subunit 6 Calculated Molecular Weight: 557 aa, 63.3 kDa Observed Molecular Weight: 63 kDa GenBank Accession Number: BC027476 Gene Symbol: CNOT6 Gene ID (NCBI): 57472 RRID: AB_2935444 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULM6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924