Proteintech, 17946-1-AP, MRGPRX3 Polyclonal antibody

Size: 20ul / 150ul The MRGPRX3 (17946-1-AP) by Proteintech is a Polyclonal antibody targeting MRGPRX3 in IHC, ELISA applications with reactivity to human, rat samples 17946-1-AP targets MRGPRX3 in IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive IHC detected in: rat dorsal root ganglion tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MRGPRX3 (Mas-related G-protein coupled receptor member X3) is a member of the mas-related/sensory neuron specific subfamily of G protein coupled receptors. MRGPRX3 may be involved in sensory neuron regulation and in the modulation of pain. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12417 Product name: Recombinant human MRGPRX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 240-322 aa of BC067292 Sequence: SRIHLDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPEVDEGGGQLPQETLELSGSRLEQ Predict reactive species Full Name: MAS-related GPR, member X3 Calculated Molecular Weight: 322 aa, 36 kDa GenBank Accession Number: BC067292 Gene Symbol: MRGPRX3 Gene ID (NCBI): 117195 RRID: AB_3669284 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96LB0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.