Proteintech, 17947-1-AP, RGN/SMP30 Polyclonal antibody

Size: 20ul / 150ul The RGN/SMP30 (17947-1-AP) by Proteintech is a Polyclonal antibody targeting RGN/SMP30 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 17947-1-AP targets RGN/SMP30 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse small intestine tissue, rat liver tissue Positive IP detected in: mouse liver tissue Positive IHC detected in: rat kidney tissue, human liver tissue, human kidney tissue, human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:3000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Regucalcin (RGN), also known as SMP30, is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. SMP30 is preferentially localized in hepatocytes and renal proximal tubular epithelial cells. It is known to be related to aging, hepatocyte proliferation and tumorigenesis. It may be useful for HCC serologic screening, especially for the patients with AFP Negative. RGN encodes two isoforms: 33 kDa and 25 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12423 Product name: Recombinant human RGN,SMP30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC073173 Sequence: MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG Predict reactive species Full Name: regucalcin (senescence marker protein-30) Calculated Molecular Weight: 299 aa, 33 kDa Observed Molecular Weight: 33 kDa, 25 kDa GenBank Accession Number: BC073173 Gene Symbol: RGN/SMP30 Gene ID (NCBI): 9104 RRID: AB_10644486 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15493 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.