Iright
BRAND / VENDOR: Proteintech

Proteintech, 17968-1-AP, uPA/Urokinase Polyclonal antibody

CATALOG NUMBER: 17968-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The uPA/Urokinase (17968-1-AP) by Proteintech is a Polyclonal antibody targeting uPA/Urokinase in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 17968-1-AP targets uPA/Urokinase in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: DU 145 cells, human brain tissue, A375 cells, Hela cells, LNCaP cells Positive IP detected in: HeLa cells Positive IHC detected in: human breast cancer tissue, human bowen disease, human lung tissue, human ovary tissue, human prostate cancer tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PLAU(Urokinase-type plasminogen activator) is also named as uPA and belongs to the peptidase S1 family.UPA initiates a proteolytic cascade, which degrades extracellular matrix during tissue growth and remodelling.The secreted proform of UPA is activated after binding to a specific high affinity cell surface receptor. Secreted UPA is exposed to rapid inactivation in the pericellular space by plasminogen activator inhibitor-1 (PAI-1), which is stored in the extracellular matrix bound to vitronectin(PMID:9665342).It has 2 isoforms produced by alternative splicing. Defects in PLAU are the cause of Quebec platelet disorder (QPD). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag11813 Product name: Recombinant human uPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-431 aa of BC013575 Sequence: ASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL Predict reactive species Full Name: plasminogen activator, urokinase Calculated Molecular Weight: 431 aa, 49 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC013575 Gene Symbol: Urokinase Gene ID (NCBI): 5328 RRID: AB_2165202 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00749 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924