Product Description
Size: 20ul / 150ul
The Cannabinoid receptor 1 (17978-1-AP) by Proteintech is a Polyclonal antibody targeting Cannabinoid receptor 1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples
17978-1-AP targets Cannabinoid receptor 1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: SH-SY5Y cells, mouse brain tissue, rat brain tissue
Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Background Information
Cannabinoid receptor 1 (CNR1, or CB1) and CNR2 (CB2) are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family. The CB1 receptor is expressed mainly in the brain. The CB2 receptor is expressed mainly in the immune system and in hematopoietic cells. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag12371 Product name: Recombinant human CNR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-121 aa of BC074812 Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAV Predict reactive species
Full Name: cannabinoid receptor 1 (brain)
Calculated Molecular Weight: 472 aa, 53 kDa
Observed Molecular Weight: 45 kDa, 66 kDa
GenBank Accession Number: BC074812
Gene Symbol: Cannabinoid receptor 1
Gene ID (NCBI): 1268
RRID: AB_10859098
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P21554
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924