Iright
BRAND / VENDOR: Proteintech

Proteintech, 17997-1-AP, INSL3 Polyclonal antibody

CATALOG NUMBER: 17997-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The INSL3 (17997-1-AP) by Proteintech is a Polyclonal antibody targeting INSL3 in WB, ELISA applications with reactivity to human, mouse, rat samples 17997-1-AP targets INSL3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information Insulin-like 3 (INSL3), a Leydig cell-specific hormone, is essential for testis descent during foetal life and bone metabolism in adults. Insl3-deficient mice exhibit bilateral undescended testes located high in the abdominal cavity. INSL3 is presumed also to conform to a heterodimeric A-B structure of approximately 6 kDa once released from the producing cells. It is possible that both the mature form of INSL3 (6.6 kDa) and the pro-form(s) of INSL3 (12-14 kDa) are secreted from mammalian Leydig cells (PMID: 19329805). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12455 Product name: Recombinant human INSL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 17-131 aa of BC071706 Sequence: LVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAAGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY Predict reactive species Full Name: insulin-like 3 (Leydig cell) Calculated Molecular Weight: 131 aa, 14 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC071706 Gene Symbol: INSL3 Gene ID (NCBI): 3640 RRID: AB_2878479 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51460 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924