Product Description
Size: 20ul / 150ul
The KCNK9 (18033-1-AP) by Proteintech is a Polyclonal antibody targeting KCNK9 in WB, ELISA applications with reactivity to human, mouse, rat samples
18033-1-AP targets KCNK9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag12603 Product name: Recombinant human KCNK9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 246-374 aa of BC075079 Sequence: FLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV Predict reactive species
Full Name: potassium channel, subfamily K, member 9
Calculated Molecular Weight: 374 aa, 42 kDa
Observed Molecular Weight: 45-50 kDa
GenBank Accession Number: BC075079
Gene Symbol: KCNK9
Gene ID (NCBI): 51305
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NPC2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924