Iright
BRAND / VENDOR: Proteintech

Proteintech, 18033-1-AP, KCNK9 Polyclonal antibody

CATALOG NUMBER: 18033-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KCNK9 (18033-1-AP) by Proteintech is a Polyclonal antibody targeting KCNK9 in WB, ELISA applications with reactivity to human, mouse, rat samples 18033-1-AP targets KCNK9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12603 Product name: Recombinant human KCNK9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 246-374 aa of BC075079 Sequence: FLTMNSEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV Predict reactive species Full Name: potassium channel, subfamily K, member 9 Calculated Molecular Weight: 374 aa, 42 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC075079 Gene Symbol: KCNK9 Gene ID (NCBI): 51305 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NPC2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924