Proteintech, 18036-1-AP, SAP102 Polyclonal antibody

Size: 20ul / 150ul The SAP102 (18036-1-AP) by Proteintech is a Polyclonal antibody targeting SAP102 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 18036-1-AP targets SAP102 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Synapse-associated protein 102 (SAP102), also known as DLG3, is a MAGUK that is highly expressed early in development and mediates receptor trafficking during synaptogenesis. The importance of SAP102 function in brain development is demonstrated by the fact that SAP102 mutations have been identified in human patients with nonsyndromic X-linked mental retardation (XLMR).SAP102 has critical roles in early cortical synapse development. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12658 Product name: Recombinant human DLG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 466-817 aa of BC093864 Sequence: RPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRDFPGLSDDYYGAKNLKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGHYIWVPSPEKL Predict reactive species Full Name: discs, large homolog 3 (Drosophila) Calculated Molecular Weight: 817 aa, 90 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC093864 Gene Symbol: SAP102 Gene ID (NCBI): 1741 RRID: AB_2092175 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92796 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.