Proteintech, 18039-1-AP, UBA52 Polyclonal antibody

Size: 20ul / 150ul The UBA52 (18039-1-AP) by Proteintech is a Polyclonal antibody targeting UBA52 in IHC, ELISA applications with reactivity to human samples 18039-1-AP targets UBA52 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: mouse ovary tissue, human kidney tissue, human placenta tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Ubiquitin is a highly conserved nuclear and cytoplasmic protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene expression, and the stress response. Ubiquitin is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin moiety fused to an unrelated protein. UBA52 is a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein L40 at the C terminus, a C-terminal extension protein (CEP). Multiple processed pseudogenes derived from this gene are present in the genome. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12669 Product name: Recombinant human UBA52 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC101830 Sequence: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK Predict reactive species Full Name: ubiquitin A-52 residue ribosomal protein fusion product 1 Calculated Molecular Weight: 128 aa, 15 kDa GenBank Accession Number: BC101830 Gene Symbol: UBA52 Gene ID (NCBI): 7311 RRID: AB_2035029 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62987 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.