Iright
BRAND / VENDOR: Proteintech

Proteintech, 18051-1-AP, DNA Ligase I Polyclonal antibody

CATALOG NUMBER: 18051-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DNA Ligase I (18051-1-AP) by Proteintech is a Polyclonal antibody targeting DNA Ligase I in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 18051-1-AP targets DNA Ligase I in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A431 cells, Jurkat cells Positive IP detected in: HepG2 cells Positive IHC detected in: human spleen tissue, human brain tissue, human placenta tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information DNA ligase I (LIG1) joins DNA strand breaks during DNA replication and repair transactions and contributes to genome integrity. 18051-1-AP is raised agains the C-terminal 670-919 aa residues of the human DNA ligase 1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12508 Product name: Recombinant human LIG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 670-919 aa of BC108318 Sequence: LVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPEDTY Predict reactive species Full Name: ligase I, DNA, ATP-dependent Calculated Molecular Weight: 919 aa, 102 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC108318 Gene Symbol: LIG1 Gene ID (NCBI): 3978 RRID: AB_2265726 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P18858 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924