Iright
BRAND / VENDOR: Proteintech

Proteintech, 18060-1-AP, FANCF Polyclonal antibody

CATALOG NUMBER: 18060-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FANCF (18060-1-AP) by Proteintech is a Polyclonal antibody targeting FANCF in IP, ELISA applications with reactivity to human samples 18060-1-AP targets FANCF in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HeLa cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information The Fanconi anemia complement group F (FANCF) is located on chromosome 11p15, a region enriched in cancer-associated genes. FANCF is known to be involved in DNA repair, and the overexpression of FANCF protein leads to cell proliferation and ultimately to cancer. The epigenetic silencing of FANCF has been reported in several different tumors such as ovaries, bladder, cervical, leukemic, testicular, lung, and oral tumors (PMID: 21915857, 32915143). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12649 Product name: Recombinant human FANCF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-374 aa of BC093867 Sequence: MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDVLLSLRLLENRALGDAARYHLVQQLFPGPGVRDADEETLQESLARLARRRSAVHMLRFNGYRENPNLQEDSLMKTQAELLLERLQEVGKAEAERPARFLSSLWERLPQNNFLKVIAVALLQPPLSRRPQEELEPGIHKSPGEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFRKRQVLGLSAGLSSV Predict reactive species Full Name: Fanconi anemia, complementation group F Calculated Molecular Weight: 374 aa, 42 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC093867 Gene Symbol: FANCF Gene ID (NCBI): 2188 RRID: AB_3669289 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NPI8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924